DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and Eif3f

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_079620.2 Gene:Eif3f / 66085 MGIID:1913335 Length:361 Species:Mus musculus


Alignment Length:281 Identity:78/281 - (27%)
Similarity:145/281 - (51%) Gaps:22/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDH 75
            |.:||::|.|:||.:.|..:  ...||:|.|||. ..|..::|:|.|:||.:|.:.:.:|   |.
Mouse    96 VRLHPVILASIVDSYERRNE--GAARVIGTLLGT-VDKHSVEVTNCFSVPHNESEDEVAV---DM 154

  Fly    76 DYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTEA 140
            ::.:|||.:.|||:..|.::|||.||..:.::.:.|:|...|..||.:.:.:|...:...:..:|
Mouse   155 EFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTGLQHGRMSIKA 219

  Fly   141 YISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDI--KDTTVGSLSQKITNQLMGLKG 203
            |:|. .:...|......|..:..:....:.|.:||:.:::..  .:..:|     :::.|..:.|
Mouse   220 YVST-LMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIG-----LSSDLQQVGG 278

  Fly   204 LNAQLRD----IKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVY 264
            .:|:::|    :.||.:.|...|:..::.:...|..:.|.:|.|..|.|...:....||.::|.|
Mouse   279 ASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTY 343

  Fly   265 LASMVRSIIALHNLINNKLAN 285
            ||::.:|.|||    |.||.|
Mouse   344 LANLTQSQIAL----NEKLVN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 78/281 (28%)
MPN_RPN7_8 9..290 CDD:163693 78/281 (28%)
Eif3fNP_079620.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
MPN_eIF3f 96..358 CDD:163695 75/277 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.