DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and stambpb

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001032659.1 Gene:stambpb / 641572 ZFINID:ZDB-GENE-051127-31 Length:418 Species:Danio rerio


Alignment Length:206 Identity:41/206 - (19%)
Similarity:69/206 - (33%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PLVLLSVVDHFNRM-------GKI-----GNQKRVV---GVLLGCWRSKGVLDVSNSFAV----- 59
            |..|.:::|...::       ||.     .|..|.|   |:|.|...       .|:|.|     
Zfish   238 PSHLTTLIDGLRQIAVPAELCGKFLRLANNNTIRAVETCGILCGTLN-------RNAFTVTHVVV 295

  Fly    60 ------PFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPK----LHQNDIAINEL 114
                  |...|.:::...||    :::.|.:.        .:||.||.|.    |...|:..:..
Zfish   296 PKQCGGPDYCDTENEEELFL----VQDQYNLI--------TLGWIHTHPTQTAFLSSVDLHTHCS 348

  Fly   115 VRRYCPNSVLVIIDAKPKDLGLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLL 179
            .:...|.|:.::...|....|........:||:   .:...|.|...|.    :.....|..|::
Zfish   349 YQMMLPESIAIVCSPKFNQTGYFRLTDYGMEEI---STCAQKGFHPHPK----DPPLFTGGSHII 406

  Fly   180 RDIKDTTVGSL 190
              |.:.||..|
Zfish   407 --ITEDTVSML 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 41/206 (20%)
MPN_RPN7_8 9..290 CDD:163693 41/206 (20%)
stambpbNP_001032659.1 USP8_dimer 13..116 CDD:286108
MPN_AMSH_like 248..418 CDD:163697 38/196 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.