Sequence 1: | NP_001261167.1 | Gene: | Rpn8 / 37894 | FlyBaseID: | FBgn0002787 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032659.1 | Gene: | stambpb / 641572 | ZFINID: | ZDB-GENE-051127-31 | Length: | 418 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 41/206 - (19%) |
---|---|---|---|
Similarity: | 69/206 - (33%) | Gaps: | 58/206 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 PLVLLSVVDHFNRM-------GKI-----GNQKRVV---GVLLGCWRSKGVLDVSNSFAV----- 59
Fly 60 ------PFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPK----LHQNDIAINEL 114
Fly 115 VRRYCPNSVLVIIDAKPKDLGLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLL 179
Fly 180 RDIKDTTVGSL 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rpn8 | NP_001261167.1 | PLN03246 | 7..308 | CDD:215645 | 41/206 (20%) |
MPN_RPN7_8 | 9..290 | CDD:163693 | 41/206 (20%) | ||
stambpb | NP_001032659.1 | USP8_dimer | 13..116 | CDD:286108 | |
MPN_AMSH_like | 248..418 | CDD:163697 | 38/196 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1310 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |