DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and STAMBPL1

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_065850.1 Gene:STAMBPL1 / 57559 HGNCID:24105 Length:436 Species:Homo sapiens


Alignment Length:71 Identity:18/71 - (25%)
Similarity:33/71 - (46%) Gaps:13/71 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DY--LENMYGMFKKVNARER----VVGWYHTGPK----LHQNDIAINELVRRYCPNSVLVIIDAK 130
            ||  :||:..:|   |.:::    .:||.||.|.    |...|:..:...:...|.::.::...|
Human   321 DYCDMENVEELF---NVQDQHDLLTLGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPK 382

  Fly   131 PKDLGL 136
            .||.|:
Human   383 HKDTGI 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 18/71 (25%)
MPN_RPN7_8 9..290 CDD:163693 18/71 (25%)
STAMBPL1NP_065850.1 USP8_dimer 28..129 CDD:286108
GBP_C <120..198 CDD:303769
MPN_AMSH_like 266..436 CDD:163697 18/71 (25%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 347..360 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.