DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and mpnd

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001070033.1 Gene:mpnd / 559169 ZFINID:ZDB-GENE-060929-1162 Length:458 Species:Danio rerio


Alignment Length:263 Identity:45/263 - (17%)
Similarity:78/263 - (29%) Gaps:106/263 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HPLVLLSVVDHFNRMGKIG-----------------NQKRVVGVLLGCW-RSKGVLDVSNSFAVP 60
            |.||.||.....||.....                 ....|||.|.|.| .:..:|.|..:|...
Zfish   210 HTLVELSAFSAINRFQPFNVAVSSNVLLLMDFHCHLTSSEVVGYLGGRWDTNTQLLTVLRAFPCR 274

  Fly    61 FDEDDKDKSVWFLDHDYLENMY--GMFKKVNARERVVGWYHT----------------------- 100
            ....|||.:. .::.:..:|::  |:        .:|||||:                       
Zfish   275 TRLADKDAAP-AVEEEICQNLFMRGL--------SLVGWYHSHPRGPALPSLQDIDSQMDHQLRL 330

  Fly   101 ---------------GPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTEAYISVEEVHDD 150
                           ||..|.|....:.:.    |..|:...:.:|.|.|:|..  :.|..|.|:
Zfish   331 QGSSNGFQPCLGIICGPYYHGNQGVASTIT----PFWVVPPPEQRPNDHGIPVA--VEVTYVQDN 389

  Fly   151 -----------------------------GSPTSKTFEHVPSEIGA----EEAEEVGVEHLLRDI 182
                                         .||.:...:.:.:.:..    ::|....:||:...:
Zfish   390 FLTTDVLNEMMLLVEFYRSAPDLVQFSQMWSPNTSILDKIKASLSGHAPKDQAYAQILEHVYNQL 454

  Fly   183 KDT 185
            ::|
Zfish   455 RNT 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 45/263 (17%)
MPN_RPN7_8 9..290 CDD:163693 45/263 (17%)
mpndNP_001070033.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..175
MPN_2A_DUB 223..407 CDD:163698 33/198 (17%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 306..319 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.