DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and eif3f

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001186938.1 Gene:eif3f / 557270 ZFINID:ZDB-GENE-100215-2 Length:273 Species:Danio rerio


Alignment Length:276 Identity:81/276 - (29%)
Similarity:140/276 - (50%) Gaps:16/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDH 75
            |.:||:||.|:||.:.|..:  ...||:|.|||. ..|..:||:|.|:||.:|.:.:.:|   |.
Zfish     8 VKIHPVVLASIVDSYERRNE--GASRVIGTLLGT-ADKHSVDVTNCFSVPHNESEDEVAV---DM 66

  Fly    76 DYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTEA 140
            ::.:|||.:.|||:..|.:||||.||..:.::.:.|:|...|..||.:.:.:|...:...:...|
Zfish    67 EFAKNMYELHKKVSPSEVIVGWYATGFDITEHSVLIHEYYSREAPNPIHLTVDTALQSNKMNIRA 131

  Fly   141 YISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITN--QLMGLKG 203
            |:| .::...|......|..:..:....:.|.:||:.|.|  ...:.|..:...|:  |:.|..|
Zfish   132 YVS-SQMGVPGKTVGVMFTPLSVKYIYYDTERIGVDLLQR--TRASPGRTNGLTTDLAQVAGAAG 193

  Fly   204 -LNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLAS 267
             :...|..:..|::.|...|:..::.:...|.|:.|.:|.|..:.|...:....||.::|.|||:
Zfish   194 RVQEMLATVLSYIEDVLSGKVMADNSVGRFLMDLVNKVPKIPAEDFENMLNSNINDLLMVTYLAN 258

  Fly   268 MVRSIIALHNLINNKL 283
            :.::.|||    |.||
Zfish   259 LTQAQIAL----NEKL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 81/276 (29%)
MPN_RPN7_8 9..290 CDD:163693 81/276 (29%)
eif3fNP_001186938.1 MPN_eIF3f 8..270 CDD:163695 79/274 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.