DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and cops6

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001265456.1 Gene:cops6 / 448375 XenbaseID:XB-GENE-947827 Length:319 Species:Xenopus tropicalis


Alignment Length:284 Identity:76/284 - (26%)
Similarity:147/284 - (51%) Gaps:17/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIVHPLVLLSVVDHFNRM-GKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLD 74
            |.:||||:|::.||:.|| .:.|...:|:|.|:|....:.: :|.|||.: ..:.:::|..  ::
 Frog    33 VALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNI-EVMNSFEL-LSQINEEKIT--IN 93

  Fly    75 HDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTE 139
            .:|.......||:|......:|||.||.....:||.:::.|.....:.:.:.::...|...||..
 Frog    94 KEYYYTKEEQFKQVFKDMEFLGWYTTGGTPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVS 158

  Fly   140 AYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGS-----LSQKITNQLM 199
            .|.||.:: .:|..|....| :...:..||||.:||:|:.|   .|..||     :::.:..|..
 Frog   159 VYESVIDI-VNGEATMLLAE-LSYTLATEEAERIGVDHVAR---MTATGSGENSTVAEHLIAQHS 218

  Fly   200 GLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVY 264
            .:|.|::::|.|.:|::.....::|.||:|:.:...:.:.||.::.|:|....|.:.||..|:.|
 Frog   219 AIKMLHSRVRLILEYVRAAEAGEVPFNHEILREASALCHCLPVLSTDKFKMDFYDQCNDVGLMSY 283

  Fly   265 LASMVRSIIALHNLIN--NKLANR 286
            |.::.::...::..:|  |.|.:|
 Frog   284 LGTITKTCNTMNQFVNKFNILYDR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 76/284 (27%)
MPN_RPN7_8 9..290 CDD:163693 76/284 (27%)
cops6NP_001265456.1 MPN_CSN6 31..313 CDD:163694 76/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.