DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and cops5

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_957019.1 Gene:cops5 / 393698 ZFINID:ZDB-GENE-040426-1686 Length:334 Species:Danio rerio


Alignment Length:316 Identity:67/316 - (21%)
Similarity:120/316 - (37%) Gaps:90/316 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLEN 80
            |.||.:|.|    .:.|....|:|::||....:.:: :.:|||:|.:..:...:.....::|:..
Zfish    58 LALLKMVMH----ARSGGNLEVMGLMLGKVDGETMI-IMDSFALPVEGTETRVNAQAAAYEYMAA 117

  Fly    81 MYGMFKKVNARERVVGWYHTGPK----LHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTEAY 141
            .....|:|...|..:||||:.|.    |...|::...|.:::....|.|:||        ||.. 
Zfish   118 YIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVID--------PTRT- 173

  Fly   142 ISVEEVH--------------DDGSPTSKTFEHVPSE---IGAEEAEEVGV---EHLLRDIKDTT 186
            ||..:|:              |:|          |||   |...:.|:.||   ::...:: ...
Zfish   174 ISAGKVNLGAFRTYPKGYKPPDEG----------PSEYQTIPLNKIEDFGVHCKQYYALEV-SYF 227

  Fly   187 VGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDI-------- 243
            ..||.:|:...|..           |.::..:..|.:..|..  |....:|:|...:        
Zfish   228 KSSLDRKLLELLWN-----------KYWVNTLSSSSLLTNAD--YTTGQVFDLSEKLEQAEAQLG 279

  Fly   244 ---------TNDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNL----INNKLANR 286
                     |:|:       |:.|::......|...:|.|:|.|    |.:||.|:
Zfish   280 RGSFMLGLDTHDR-------KSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQ 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 67/316 (21%)
MPN_RPN7_8 9..290 CDD:163693 67/316 (21%)
cops5NP_957019.1 MPN_RPN11_CSN5 42..312 CDD:163700 60/298 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 136..149 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.