DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and CG4751

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_609495.1 Gene:CG4751 / 34551 FlyBaseID:FBgn0032348 Length:1412 Species:Drosophila melanogaster


Alignment Length:401 Identity:79/401 - (19%)
Similarity:130/401 - (32%) Gaps:159/401 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NKVIVHPLVLLSVVDHFNRMGKIG--------------------NQKRVVGVLLGCW-RSKGVLD 52
            |:.:||...:|.....|..:||:.                    ..:.|.|.|.|.| .:...|.
  Fly   257 NRNVVHDANMLIESVPFTSVGKLQPFLITVNSSALLLADFHCHLTVREVCGYLGGTWDMNTHTLS 321

  Fly    53 VSNSF---AVPFD-----EDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPK------ 103
            ::.::   :..||     |.::|.....:....|               :|||||:.||      
  Fly   322 ITKTYPCRSTRFDRQRAGEVERDIQKMMIQDQLL---------------LVGWYHSHPKFQAEPT 371

  Fly   104 LHQNDIAINELVR-------RYCPNSVLVI---IDAKP------KDLGL--PTEAYISVEEVHDD 150
            |...|..::..::       .|.|...|:|   .|..|      |.:.:  |.|...|:|.    
  Fly   372 LRDCDAQLDYQIKMRGASDLTYTPCVSLIISPYYDENPTLESVVKCIWIVPPNENRQSMEY---- 432

  Fly   151 GSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQLMGLKGLNAQLRDIKQYL 215
            |.|....:..:|.:   |..|||..|                                      :
  Fly   433 GRPMLMQYSVLPDK---EIPEEVRSE--------------------------------------I 456

  Fly   216 QRVGDSKMPINHQIVYQLQDIFNLLPDIT-NDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNLI 279
            |...|.......::| :.::|:|  .|:| |::...|:|.|...:          :|..||.|.|
  Fly   457 QLCVDYYSQYRSEMV-KFRNIYN--NDVTYNEKLKNTLYPKFPSK----------QSDKALWNWI 508

  Fly   280 NNKLANRDAEEG------------KSDSKEAKEKNK---------DSKDKDNKETK--------D 315
               .|..|.|:.            .:|..|.||::|         |.|....||.:        :
  Fly   509 ---CAVLDCEQEDDFIPPKTIKIIDNDDLEVKEEDKPVVLMDLSGDVKINPPKEEQFSEAMGGLE 570

  Fly   316 KDGKKAEEKAD 326
            ..|:||||:::
  Fly   571 DSGRKAEEESN 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 72/373 (19%)
MPN_RPN7_8 9..290 CDD:163693 64/334 (19%)
CG4751NP_609495.1 MPN_2A_DUB 278..463 CDD:163698 42/244 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.