DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and Rpn11

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster


Alignment Length:317 Identity:72/317 - (22%)
Similarity:120/317 - (37%) Gaps:61/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVNKVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVW 71
            :..:|.:..|.||.::.|    |:.|....|:|::||.:.....:.|.:.||:|  :.....||.
  Fly    25 TAEQVYISSLALLKMLKH----GRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMP--QTGTGVSVE 83

  Fly    72 FLDHDYLENMYGMFKKVNARERVVGWYHTGPK----LHQNDIAINELVRRYCPNSVLVIIDAKPK 132
            .:|..:...|..|.|:....|.||||||:.|.    |...||...:........:|.|::|    
  Fly    84 AVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVD---- 144

  Fly   133 DLGLPTEAYISVEEVHDDGSPTSKTFEHVPSE---IGAEEAEEVGVEHLLRDIKDTTVGSLSQKI 194
                |.:   ||:     |......|..:...   :|.|..:..           :.:|.| ||.
  Fly   145 ----PIQ---SVK-----GKVVIDAFRLINPNMLVLGQEPRQTT-----------SNLGHL-QKP 185

  Fly   195 TNQLMGLKGLNAQLRDIK-QYLQRVGDSKMPIN-HQIVYQ----LQDIFNLLPDITNDQFTGTMY 253
            :.|.: :.|||.....|. .|.:...:.||.:| |:..::    |.| :|....|..|.....:.
  Fly   186 SVQAL-IHGLNRHYYSISINYRKNELEQKMLLNLHKKSWKDGLTLSD-YNEHCSINEDTVAEMLD 248

  Fly   254 VKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAEEGKSDSKEAKEKNKDSKDKDN 310
            :..|....:.....|....:|:.|:            ||.|.|...|:..|...::|
  Fly   249 LAKNYNKSLEDEEKMTPEQLAIKNV------------GKQDPKRHLEEKVDKVMQNN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 71/313 (23%)
MPN_RPN7_8 9..290 CDD:163693 65/293 (22%)
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 69/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.