DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and Brcc3

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001120772.1 Gene:Brcc3 / 316794 RGDID:1588543 Length:291 Species:Rattus norvegicus


Alignment Length:168 Identity:36/168 - (21%)
Similarity:58/168 - (34%) Gaps:32/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RVVGWYHTGPKL----HQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPT--EAYISVEEVHDDG 151
            |||||||:.|.:    ...|:....:.:......|.:|.....:|....|  ..|...:.|....
  Rat   116 RVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSVQAQK 180

  Fly   152 SPTSKTFE-------HV-------------PSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITN 196
            |...:..|       ||             |..:..||.:.....|.|..:...|      ||.|
  Rat   181 SSDYERIEIPVHVVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVT------KIHN 239

  Fly   197 QLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQ 234
            ..:..|.|.:|:..:...|.:..:.::..|.|.:.:||
  Rat   240 GSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLRELQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 36/168 (21%)
MPN_RPN7_8 9..290 CDD:163693 36/168 (21%)
Brcc3NP_001120772.1 MPN_BRCC36 13..270 CDD:163699 32/159 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 122..135 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.