DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and Cops6

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001100599.1 Gene:Cops6 / 304343 RGDID:1309919 Length:344 Species:Rattus norvegicus


Alignment Length:284 Identity:75/284 - (26%)
Similarity:145/284 - (51%) Gaps:17/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIVHPLVLLSVVDHFNRM-GKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLD 74
            |.:||||:|::.||:.|| .:.|...:|:|.|:|....:.: :|.|||.:.  ....:|.: .:|
  Rat    58 VALHPLVILNISDHWIRMRSQEGRPMQVIGALIGKQEGRNI-EVMNSFELL--SHTVEKKI-IID 118

  Fly    75 HDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTE 139
            .:|.......||:|......:|||.||.....:||.:::.|.....:.:.:.::...|...||..
  Rat   119 KEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVS 183

  Fly   140 AYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGS-----LSQKITNQLM 199
            .:.||.:: .:|..| ..|..:...:..||||.:||:|:.|   .|..||     :::.:..|..
  Rat   184 VFESVIDI-INGEAT-MLFAELTYTLATEEAERIGVDHVAR---MTATGSGENSTVAEHLIAQHS 243

  Fly   200 GLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVY 264
            .:|.|:::::.|.:|::.....::|.||:|:.:...:.:.||.::.|:|....|.:.||..|:.|
  Rat   244 AIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAY 308

  Fly   265 LASMVRSIIALHNLIN--NKLANR 286
            |.::.::...::..:|  |.|.:|
  Rat   309 LGTITKTCNTMNQFVNKFNVLYDR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 75/284 (26%)
MPN_RPN7_8 9..290 CDD:163693 75/284 (26%)
Cops6NP_001100599.1 MPN_CSN6 56..338 CDD:163694 75/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.