DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and Mysm1

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_008762133.1 Gene:Mysm1 / 298247 RGDID:1311787 Length:811 Species:Rattus norvegicus


Alignment Length:223 Identity:44/223 - (19%)
Similarity:82/223 - (36%) Gaps:64/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTEAYISVEEVHDDG---SPTS 155
            |:||||:.|              .:.||..|..||.:.|     .::|.|.......|   ||.:
  Rat   634 VIGWYHSHP--------------AFDPNPSLRDIDTQAK-----YQSYFSRGGAKFIGMIVSPYN 679

  Fly   156 KT----FEHVPSEIGAEEAEEVG---------VEHLLRDIKDTTVGSLSQKITNQLMGLKGLNAQ 207
            ::    :..:...:.:||....|         |:.:|.:.:...|...::.|             
  Rat   680 RSNPLPYSQITCLVISEELSPDGTYRLPYKFEVQQMLEEPQWELVFEKTRWI------------- 731

  Fly   208 LRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSI 272
               |::|  |:..|.:|::.        ||....|:|..|.......||..::...::|.  ..:
  Rat   732 ---IEKY--RLSHSSVPMDR--------IFRRDSDLTCLQKLLECLRKTLSKVANCFIAE--EFL 781

  Fly   273 IALHNLINNKLANRDAEEGKSDSKEAKE 300
            ..:.||..:...::: |.|.::...|||
  Rat   782 TQVENLFLSNYKSKE-ENGLAEENSAKE 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 44/223 (20%)
MPN_RPN7_8 9..290 CDD:163693 39/211 (18%)
Mysm1XP_008762133.1 Myb_DNA-binding 116..160 CDD:395191
SWIRM 365..444 CDD:398234
MPN_2A_DUB 554..736 CDD:163698 26/138 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.