DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and csn-5

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_500841.1 Gene:csn-5 / 177342 WormBaseID:WBGene00000817 Length:368 Species:Caenorhabditis elegans


Alignment Length:270 Identity:62/270 - (22%)
Similarity:114/270 - (42%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKG--VLDVSNSFAVPFDEDDKDKSVWF 72
            ::.:..:.||.:..|..|.|.:    .::|:|.|...:..  :|||   ||:|.:..:...:...
 Worm    55 QIKISAIALLKMTMHAKRGGNL----EIMGLLQGRIDANSFIILDV---FALPVEGTETRVNAQA 112

  Fly    73 LDHDYLENMYGMFKKVNARERVVGWYHTGPK----LHQNDIAINELVRRYCPNSVLVIID----- 128
            ..::|:.....|......:|:||||||:.|.    |...|::...|.:::....|.::||     
 Worm   113 QAYEYMTVYSEMCDTEGRKEKVVGWYHSHPGYGCWLSGIDVSTQTLNQKFQEPWVAIVIDPLRTM 177

  Fly   129 -AKPKDLGLPTEAYISVEEVH---DDGSPTSKTFEHVPSE---IGAEEAEEVGVE---------- 176
             |...|:|    |:.:..|.:   ||          ||||   |...:.|:.||.          
 Worm   178 SAGKVDIG----AFRTYPEGYRPPDD----------VPSEYQSIPLAKIEDFGVHCKRYYSLDVS 228

  Fly   177 --------HLLRDIKDT-TVGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQ 232
                    |:|..:.:: .:.:||.  :.....::.||.|::||.|.|..| |.|:.:|.:.|..
 Worm   229 FFKSQLDAHILTSLWNSYWISTLSS--SPLFSNVEFLNNQIQDINQKLSAV-DKKLQLNDRSVDG 290

  Fly   233 LQDIFNLLPD 242
            .:.:..::.|
 Worm   291 HEALMKVVTD 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 62/270 (23%)
MPN_RPN7_8 9..290 CDD:163693 62/270 (23%)
csn-5NP_500841.1 MPN_RPN11_CSN5 45..292 CDD:163700 61/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.