DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and eif-3.F

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_495988.1 Gene:eif-3.F / 174478 WormBaseID:WBGene00001229 Length:294 Species:Caenorhabditis elegans


Alignment Length:309 Identity:80/309 - (25%)
Similarity:139/309 - (44%) Gaps:57/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SQEVSVNKVIVHPLVLLSVVD-HFNR---MGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDE 63
            :..::||   |||.|.::||| |..|   ..|...|::.:|.|:| :..||.:.|:|.||:||:|
 Worm     2 ASNLTVN---VHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMG-YYEKGSIQVTNCFAIPFNE 62

  Fly    64 DDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELV------------- 115
            .:.|..:   |..:.:.|....||.:..|:.|||:     |..:||..:.|:             
 Worm    63 SNDDLEI---DDQFNQQMISALKKTSPNEQPVGWF-----LTTSDITSSCLIYHDYYVRVITEAS 119

  Fly   116 -RRYCPNSVLVIIDAK-PKDLG--LPTEAYI-SVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGV 175
             ||..|..|::.||.. ..|:.  :|..||: |...:.....|....|..:..|:.|...|.|.:
 Worm   120 ARRESPPIVVLTIDTTFSGDMSKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGELVAM 184

  Fly   176 EHLLRDI----KDTTVGS-LSQKITNQLMGLKGLNAQL---RDIKQYLQRVGDSKMPINHQIVYQ 232
            :.:.:.:    ::.|:.| |.|..|:....::.|...|   .|:.:..::.||:      ||..|
 Worm   185 QLIEKALDSRRREATLESGLEQLETSTAQMIEWLERMLHYVEDVNKNGEKPGDA------QIGRQ 243

  Fly   233 LQDIF-----NLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSIIALH 276
            |.||.     |:.|:..:.....|:    .|.::|.|||.:.::.:.:|
 Worm   244 LMDIVTASSNNMQPEKLDTLVKNTL----RDYVMVSYLAKLTQTQLQVH 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 80/305 (26%)
MPN_RPN7_8 9..290 CDD:163693 79/303 (26%)
eif-3.FNP_495988.1 MPN_eIF3f 7..291 CDD:163695 80/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.