powered by:
Protein Alignment Rpn8 and MYSM1
DIOPT Version :9
Sequence 1: | NP_001261167.1 |
Gene: | Rpn8 / 37894 |
FlyBaseID: | FBgn0002787 |
Length: | 358 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078956.1 |
Gene: | MYSM1 / 114803 |
HGNCID: | 29401 |
Length: | 828 |
Species: | Homo sapiens |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 30/71 - (42%) |
Gaps: | 13/71 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 94 VVGWYHTGPKLHQN----DIAINELVRRYCPNS----VLVIIDAKPKDLGLP----TEAYISVEE 146
|:||||:.|....| ||......:.|.... :.:|:....::..|| |...|| ||
Human 651 VIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGMIVSPYNRNNPLPYSQITCLVIS-EE 714
Fly 147 VHDDGS 152
:..|||
Human 715 ISPDGS 720
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1310 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.