DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rpn8 and MYSM1

DIOPT Version :9

Sequence 1:	NP_001261167.1	Gene:	Rpn8 / 37894	FlyBaseID:	FBgn0002787	Length:	358	Species:	Drosophila melanogaster
Sequence 2:	NP_001078956.1	Gene:	MYSM1 / 114803	HGNCID:	29401	Length:	828	Species:	Homo sapiens

Alignment Length:	71	Identity:	21/71 - (29%)
Similarity:	30/71 - (42%)	Gaps:	13/71 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    94 VVGWYHTGPKLHQN----DIAINELVRRYCPNS----VLVIIDAKPKDLGLP----TEAYISVEE 146
            |:||||:.|....|    ||......:.|....    :.:|:....::..||    |...|| ||
Human   651 VIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGMIVSPYNRNNPLPYSQITCLVIS-EE 714

  Fly   147 VHDDGS 152
            :..|||
Human   715 ISPDGS 720

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rpn8	NP_001261167.1	PLN03246	7..308	CDD:215645	21/71 (30%)
Rpn8	NP_001261167.1	MPN_RPN7_8	9..290	CDD:163693	21/71 (30%)
MYSM1	NP_001078956.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..31
		SANT	120..164	CDD:197842
		Myb_DNA-binding	120..162	CDD:278669
		SWIRM	382..461	CDD:282311
		MPN_2A_DUB	571..753	CDD:163698	21/71 (30%)
		JAMM motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01182	656..669		3/12 (25%)
		LXXLL motif	774..778
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1310
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810