DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and COPS5

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_006828.2 Gene:COPS5 / 10987 HGNCID:2240 Length:334 Species:Homo sapiens


Alignment Length:319 Identity:67/319 - (21%)
Similarity:121/319 - (37%) Gaps:90/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDY 77
            :..|.||.:|.|    .:.|....|:|::||....:.:: :.:|||:|.:..:...:.....::|
Human    57 ISALALLKMVMH----ARSGGNLEVMGLMLGKVDGETMI-IMDSFALPVEGTETRVNAQAAAYEY 116

  Fly    78 LENMYGMFKKVNARERVVGWYHTGPK----LHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPT 138
            :.......|:|...|..:||||:.|.    |...|::...|.:::....|.|:||        ||
Human   117 MAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVID--------PT 173

  Fly   139 EAYISVEEVH--------------DDGSPTSKTFEHVPSE---IGAEEAEEVGV---EHLLRDIK 183
            .. ||..:|:              |:|          |||   |...:.|:.||   ::...:: 
Human   174 RT-ISAGKVNLGAFRTYPKGYKPPDEG----------PSEYQTIPLNKIEDFGVHCKQYYALEV- 226

  Fly   184 DTTVGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDI----- 243
            .....||.:|:...|..           |.::..:..|.:..|..  |....:|:|...:     
Human   227 SYFKSSLDRKLLELLWN-----------KYWVNTLSSSSLLTNAD--YTTGQVFDLSEKLEQSEA 278

  Fly   244 ------------TNDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNL----INNKLANR 286
                        |:|:       |:.|::......|...:|.|:|.|    |.:||.|:
Human   279 QLGRGSFMLGLETHDR-------KSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQ 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 67/319 (21%)
MPN_RPN7_8 9..290 CDD:163693 67/319 (21%)
COPS5NP_006828.2 MPN_RPN11_CSN5 44..314 CDD:163700 60/301 (20%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 138..151 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.