DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and COPS6

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_006824.2 Gene:COPS6 / 10980 HGNCID:21749 Length:327 Species:Homo sapiens


Alignment Length:284 Identity:75/284 - (26%)
Similarity:146/284 - (51%) Gaps:17/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIVHPLVLLSVVDHFNRM-GKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLD 74
            |.:||||:|::.||:.|| .:.|...:|:|.|:|....:.: :|.|||.: .....::|.:  :|
Human    41 VALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNI-EVMNSFEL-LSHTVEEKII--ID 101

  Fly    75 HDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDLGLPTE 139
            .:|.......||:|......:|||.||.....:||.:::.|.....:.:.:.::...|...||..
Human   102 KEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVS 166

  Fly   140 AYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGS-----LSQKITNQLM 199
            .:.||.:: .:|..| ..|..:...:..||||.:||:|:.|   .|..||     :::.:..|..
Human   167 VFESVIDI-INGEAT-MLFAELTYTLATEEAERIGVDHVAR---MTATGSGENSTVAEHLIAQHS 226

  Fly   200 GLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVY 264
            .:|.|:::::.|.:|::.....::|.||:|:.:...:.:.||.::.|:|....|.:.||..|:.|
Human   227 AIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAY 291

  Fly   265 LASMVRSIIALHNLIN--NKLANR 286
            |.::.::...::..:|  |.|.:|
Human   292 LGTITKTCNTMNQFVNKFNVLYDR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 75/284 (26%)
MPN_RPN7_8 9..290 CDD:163693 75/284 (26%)
COPS6NP_006824.2 MPN_CSN6 39..321 CDD:163694 75/284 (26%)
Interaction with Vpr 211..327 24/105 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.