DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn8 and mysm1

DIOPT Version :9

Sequence 1:NP_001261167.1 Gene:Rpn8 / 37894 FlyBaseID:FBgn0002787 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_012817008.2 Gene:mysm1 / 100126685 XenbaseID:XB-GENE-1032957 Length:860 Species:Xenopus tropicalis


Alignment Length:207 Identity:39/207 - (18%)
Similarity:60/207 - (28%) Gaps:79/207 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VVGWYHTGPKLHQN----DIAINELVRRYCPNSVLVIIDAKPKDLGLPTEAY------------- 141
            |:||||:.|....|    ||......:.|...       ...|.||:....|             
 Frog   659 VIGWYHSHPAFDPNPSIRDIDTQAKYQNYFSR-------GGAKFLGMIISPYNQRNPHPQSQVSC 716

  Fly   142 -ISVEEVHDDGS---PTSKTFEHVPSEIGAE----------------------------EAEEVG 174
             |..:|:..|||   |.....|::..|:..|                            ::|...
 Frog   717 LIISDELSKDGSYRIPYKFDVEYMQGELQWELVFEKTRWIIEKYKSSHSSVSMNKRFRHDSELTC 781

  Fly   175 VEHLLRDIKDTTVGSLSQKITNQLM-------------GLKGLNAQLRDIKQYLQRVGD------ 220
            ::.||..:|.|...:....:|.:|:             ..:..|.:..:...|.|.|..      
 Frog   782 LQKLLICMKKTLGNTTCPLLTEELLLHRIEEFFLTSYNTSRKSNYETEEHDPYKQNVDTIVARDS 846

  Fly   221 ----SKMPINHQ 228
                ||.|..||
 Frog   847 FQDYSKEPNGHQ 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn8NP_001261167.1 PLN03246 7..308 CDD:215645 39/207 (19%)
MPN_RPN7_8 9..290 CDD:163693 39/207 (19%)
mysm1XP_012817008.2 Myb_DNA-binding 122..166 CDD:395191
SWIRM 391..470 CDD:398234
MPN_2A_DUB 579..761 CDD:163698 23/108 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.