Sequence 1: | NP_932787.1 | Gene: | Lrrc24 / 378937 | MGIID: | 3605040 | Length: | 521 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
Alignment Length: | 275 | Identity: | 82/275 - (29%) |
---|---|---|---|
Similarity: | 120/275 - (43%) | Gaps: | 29/275 - (10%) |
- Green bases have known domain annotations that are detailed below.
Mouse 6 PTLLLLLLGLLLLPLLPGLPPRATGCPAACRCYSATVECGAL----RLRVVPPGIPPGTQTLFLQ 66
Mouse 67 DNSIAHLEQGSLAPLAALRHLYLHNNTLRALESGAFRAQPRLLELALTGNRLRGLRGGAFVGLVQ 131
Mouse 132 LRVLYLAGNQLAKLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISKE 196
Mouse 197 ALQPLSSLQVLRLTENPWRCDCALHWLGSWIK----EGGRRLLSSRDKKITCAEPPRLALQSL-- 255
Mouse 256 ---LEVSGGSLICIP 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lrrc24 | NP_932787.1 | LRR_8 | 48..92 | CDD:290566 | 15/43 (35%) |
LRR 1 | 59..80 | 8/20 (40%) | |||
LRR_RI | <60..>166 | CDD:238064 | 35/105 (33%) | ||
leucine-rich repeat | 61..83 | CDD:275380 | 7/21 (33%) | ||
LRR 2 | 83..104 | 7/20 (35%) | |||
LRR_8 | 84..142 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 84..107 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 107..128 | 7/20 (35%) | |||
leucine-rich repeat | 108..131 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 131..213 | CDD:290566 | 23/81 (28%) | ||
LRR_4 | 131..171 | CDD:289563 | 12/39 (31%) | ||
LRR 4 | 131..152 | 4/20 (20%) | |||
leucine-rich repeat | 132..155 | CDD:275380 | 5/22 (23%) | ||
LRR 5 | 155..176 | 9/20 (45%) | |||
leucine-rich repeat | 156..179 | CDD:275380 | 10/22 (45%) | ||
LRR 6 | 179..200 | 5/20 (25%) | |||
leucine-rich repeat | 180..203 | CDD:275380 | 6/22 (27%) | ||
LRRCT | 212..265 | CDD:214507 | 12/61 (20%) | ||
Ig | 267..361 | CDD:299845 | 1/1 (100%) | ||
IG_like | 274..370 | CDD:214653 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 306..330 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 374..395 | ||||
Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | 8/22 (36%) |
leucine-rich repeat | 98..121 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 120..180 | CDD:404697 | 19/59 (32%) | ||
leucine-rich repeat | 122..145 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 146..169 | CDD:275380 | 5/22 (23%) | ||
LRR | <161..>354 | CDD:227223 | 32/130 (25%) | ||
leucine-rich repeat | 170..193 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 194..217 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 218..265 | CDD:275380 | 11/56 (20%) | ||
leucine-rich repeat | 266..289 | CDD:275380 | 4/15 (27%) | ||
leucine-rich repeat | 290..313 | CDD:275380 | |||
leucine-rich repeat | 314..338 | CDD:275380 | |||
LRR_8 | 337..397 | CDD:404697 | |||
leucine-rich repeat | 339..360 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |