DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slik and MEKK1

DIOPT Version :10

Sequence 1:NP_726441.1 Gene:Slik / 37893 FlyBaseID:FBgn0035001 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_192590.1 Gene:MEKK1 / 826409 AraportID:AT4G08500 Length:608 Species:Arabidopsis thaliana


Alignment Length:91 Identity:22/91 - (24%)
Similarity:38/91 - (41%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 AKQLPLILVKTPTSNMGIASVPMNDVRNNNSHGNYVDIDTIDQILMQQSEANQYRLQKQQQQQMF 161
            ||||..:  |....|   :..|...||...|....:|:..: |:..|...|.:.||:|...:|.:
plant   166 AKQLETL--KNAYKN---SPKPARHVREQLSSETGLDMRVV-QVWFQNRRAKEKRLKKDAGRQRW 224

  Fly   162 LQEEHEQKQLQQQHLQRQASQQHQKD 187
            .|   ..|.:::..|.:...:...:|
plant   225 GQ---FYKSVRKSRLGKSGKESSTED 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlikNP_726441.1 STKc_SLK_like 31..310 CDD:132942 22/91 (24%)
PKK 958..1095 CDD:463600
PKK 1126..1266 CDD:463600
MEKK1NP_192590.1 STKc_MEKK1_plant 332..587 CDD:270802
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.