DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slik and Mkk4

DIOPT Version :9

Sequence 1:NP_726441.1 Gene:Slik / 37893 FlyBaseID:FBgn0035001 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster


Alignment Length:293 Identity:90/293 - (30%)
Similarity:146/293 - (49%) Gaps:18/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GELGDGAFGKVYKAQHKE-QKRFAAAKMCQLEDEENLSDHMVEIDILSEIKH-PNIVELYEAFSI 103
            ||:|.||||.|.|...|: .|..|..::....||:.....:::::::.:... ..||:.|.|...
  Fly   126 GEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFK 190

  Fly   104 DDKLWMLIEYCDGGALDS----IMVELEKPLTEPQIAYVCKHMTEGLTFLHRN-KVIHRDLKAGN 163
            :...|:.:|..| .:||.    |..:.::.:.|..:|.:.......|.:|... |:||||:|..|
  Fly   191 EGDCWICMELMD-TSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSN 254

  Fly   164 VLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPELVLCETFRDNPYDHKVDIWSLGITL 228
            :||...|.:||.|||:|.:...::.|.......|| ||||.:  :..|...||.:.|:|||||||
  Fly   255 ILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPY-MAPERI--DPERAKGYDVRSDVWSLGITL 316

  Fly   229 IELAQMEPPNSEM-SPMRVLLKIQKSEPPKL---EQPSRWSKEFNDFLKKSLVKDPQVRPTTDVL 289
            :|:|....|..:. |....|.::.:.|||:|   .....:||||.||:...|:|....||....|
  Fly   317 MEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRL 381

  Fly   290 MQHAFINRNLDAKPIKDLLLEYKAEVVEEVVDD 322
            ::..||.|...:.  .|:.: |.|:::|.:..|
  Fly   382 LEMPFIRRGETSH--TDVAV-YVADILESMEKD 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SlikNP_726441.1 STKc_SLK_like 31..310 CDD:132942 86/279 (31%)
S_TKc 37..295 CDD:214567 82/264 (31%)
PKK 958..1095 CDD:289257
PKK 1126..1266 CDD:289257
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 88/285 (31%)
S_TKc 123..387 CDD:214567 82/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.