DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF148 and RKR1

DIOPT Version :9

Sequence 1:NP_932351.1 Gene:RNF148 / 378925 HGNCID:22411 Length:305 Species:Homo sapiens
Sequence 2:NP_013975.1 Gene:RKR1 / 855289 SGDID:S000004861 Length:1562 Species:Saccharomyces cerevisiae


Alignment Length:287 Identity:59/287 - (20%)
Similarity:108/287 - (37%) Gaps:89/287 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    53 TSELGESGVFGNH-SP-----LERVSGVV--ALPEGWNQNACHPLTNFSRPKQADSWLALIERGG 109
            |.|:.|..:.||: ||     .|....::  .|.:.:|...|  ||:.       .||.:.:|  
Yeast  1324 TKEISEYNIVGNNFSPYKEDIFEECKKLLGHTLYQLFNNVGC--LTSI-------WWLNIKDR-- 1377

Human   110 CTFTHKINVAAEKGANGVIIYN-YQGTGSKVFPMSHQGTENIVAVMISNL------------KGM 161
             |..:.|.....:..:.::|.| :....||:..::  ..::.:.:.::|:            :.:
Yeast  1378 -TLQNDIEKFVSEFISPILIKNEFDDINSKMDRLT--SNDDALTIKLNNITNEVKASYLIDDQKL 1439

Human   162 EILHSIQK-----GVYVTVIIEVGRMHMQWVSHYIM---YLFTFLAATIAYFYLDCVWRLTPRVP 218
            ||...:.|     .:.|..:..||....:| ..:||   ::.|.:..::    ||.:...|..|.
Yeast  1440 EISFKLPKNYPLTNIQVNGVSRVGISEQKW-KQWIMSTQHVITGMNGSV----LDSLELFTKNVH 1499

Human   219 NSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKPQDVVRIL------TCK 277
            ..|:                        |.||       |.:|:......|  |.|      |||
Yeast  1500 LQFS------------------------GFEE-------CAICYSILHAVD--RKLPSKTCPTCK 1531

Human   278 HFFHKACIDPWLLA--HRTCPMCKCDI 302
            :.||.||:..|..:  :.|||:|:.:|
Yeast  1532 NKFHGACLYKWFRSSGNNTCPLCRSEI 1558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF148NP_932351.1 PA_GRAIL_like 43..177 CDD:239037 27/149 (18%)
zf-RING_2 256..299 CDD:290367 16/50 (32%)
RKR1NP_013975.1 COG5219 1..1561 CDD:227544 59/287 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.