DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF148 and APE3

DIOPT Version :9

Sequence 1:NP_932351.1 Gene:RNF148 / 378925 HGNCID:22411 Length:305 Species:Homo sapiens
Sequence 2:NP_009845.2 Gene:APE3 / 852589 SGDID:S000000490 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:121 Identity:32/121 - (26%)
Similarity:47/121 - (38%) Gaps:40/121 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    95 PKQADSWLALIERGGCTFTHKINVAAEKGANGVIIYNYQGTGSKVFPMSHQGTENIVAVMISNLK 159
            |:..:..:||||||.|.|..|.|:|.:.|...|:||:.:       |.|.:|....:        
Yeast   198 PRHNEKQIALIERGKCPFGDKSNLAGKFGFTAVVIYDNE-------PKSKEGLHGTL-------- 247

Human   160 GMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIA-------YFYLD 208
            |....|::   ..|.|..:||:.               |.|.||       ||.:|
Yeast   248 GEPTKHTV---ATVGVPYKVGKK---------------LIANIALNIDYSLYFAMD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF148NP_932351.1 PA_GRAIL_like 43..177 CDD:239037 23/81 (28%)
zf-RING_2 256..299 CDD:290367
APE3NP_009845.2 M28_SGAP_like 78..506 CDD:349873 32/121 (26%)
PA_ScAPY_like 155..284 CDD:239045 31/118 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.