DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF148 and gol

DIOPT Version :9

Sequence 1:NP_932351.1 Gene:RNF148 / 378925 HGNCID:22411 Length:305 Species:Homo sapiens
Sequence 2:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster


Alignment Length:231 Identity:83/231 - (35%)
Similarity:126/231 - (54%) Gaps:13/231 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    85 ACHPLTNFSR----PKQADSWLALIERGGCTFTHKINVAAEKGANGVIIYNYQGTGSKVFPMSHQ 145
            ||.|....:.    |.:.::|:||:.||.|||..|:....::.|.||||||.:.. .::..|..:
  Fly   121 ACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQV-MQLEKMQIK 184

Human   146 G-TENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAAT-IAYFYLD 208
            | |.||.||:.....|.::..::.||..||:.|..||..::.:|........|::.: |....:.
  Fly   185 GKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIIS 249

Human   209 CVWRLTPRVPN-SFTRRRSQIKTDV----KKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKPQ 268
            .||.:...:.. .:.:.:.|...::    ||||.::..:..|..||: ||:.|.|.:|.:.|||.
  Fly   250 LVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEK-DLDSDCCAICIEAYKPT 313

Human   269 DVVRILTCKHFFHKACIDPWLLAHRTCPMCKCDILK 304
            |.:|||.|||.|||.||||||:.||||||||.|:||
  Fly   314 DTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF148NP_932351.1 PA_GRAIL_like 43..177 CDD:239037 32/96 (33%)
zf-RING_2 256..299 CDD:290367 28/42 (67%)
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 32/96 (33%)
UPF0233 226..>258 CDD:299753 5/31 (16%)
zf-RING_2 301..344 CDD:290367 28/42 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.