DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF148 and rnf128a

DIOPT Version :9

Sequence 1:NP_932351.1 Gene:RNF148 / 378925 HGNCID:22411 Length:305 Species:Homo sapiens
Sequence 2:NP_997780.1 Gene:rnf128a / 322325 ZFINID:ZDB-GENE-030131-1044 Length:389 Species:Danio rerio


Alignment Length:308 Identity:137/308 - (44%)
Similarity:181/308 - (58%) Gaps:19/308 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     8 PSTHSSVSSGLLRLSIFLLLSFPDSNGKAIWTAHLNITF--QVGNEITSELGESGVFGNHSPLER 70
            |.....|.|.||..|:..:.|...:....:.||:|||::  ...|..|....|.|::|..||...
Zfish     3 PLASRDVFSWLLLASVLQVSSVRLAEASYLCTAYLNISYTNPENNRSTWFQEEMGLYGQDSPKAY 67

Human    71 VSGVVALPEGWNQNACHPLTNFSRPKQADSWLALIERG-GCTFTHKINVAAEKGANGVIIYNYQG 134
            |.|.|.|..  ....|...|.:.||..:..|:|||:|| |||||.|||:||..||...||:|..|
Zfish    68 VKGNVYLAS--PTYGCDDDTFYGRPNGSKGWIALIQRGNGCTFTEKINIAAMNGAAAAIIFNDFG 130

Human   135 TGSKVFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMY-----L 194
            :.::|..|||.|| .|||:||.|.:|||::..:.:||.|.:.||||:.|..|:|||.::     .
Zfish   131 SENRVIQMSHPGT-TIVAIMIGNYRGMELVQLLDQGVPVAIAIEVGKQHGPWMSHYSVFFVSISF 194

Human   195 FTFLAATIAYFYLDCVWRLTPRVPNSF---TRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNED 256
            |...|||:.||......||     ||.   .|.:.::|.:.||||.|||:|.|::||:|:..:.|
Zfish   195 FIVTAATVGYFIFYSARRL-----NSLRQQNRSQKKLKAEAKKAIGQLQVRTLRQGDQEIGPDAD 254

Human   257 NCVVCFDTYKPQDVVRILTCKHFFHKACIDPWLLAHRTCPMCKCDILK 304
            .|.||.|:||..||:.||||.|||||:||:||||.|||||||||||||
Zfish   255 ACAVCIDSYKAGDVLSILTCNHFFHKSCIEPWLLEHRTCPMCKCDILK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF148NP_932351.1 PA_GRAIL_like 43..177 CDD:239037 57/136 (42%)
zf-RING_2 256..299 CDD:290367 30/42 (71%)
rnf128aNP_997780.1 PA_GRAIL_like 38..172 CDD:239037 57/136 (42%)
zf-RING_2 256..297 CDD:290367 29/40 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I37192
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.