DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF148 and rnf128

DIOPT Version :9

Sequence 1:NP_932351.1 Gene:RNF148 / 378925 HGNCID:22411 Length:305 Species:Homo sapiens
Sequence 2:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis


Alignment Length:309 Identity:152/309 - (49%)
Similarity:197/309 - (63%) Gaps:25/309 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    17 GLLR----------LSIFLLLSFPDSNGKAIWTAHLNITFQVGNEITSELGESGVFGNHSPLERV 71
            |:||          |...|||:...:....:|||::|.::...|....|.||.||||..||:||.
 Frog     2 GVLRMPRQFLPFPCLPALLLLNLSLTGADTLWTANVNYSYVYDNRTYGEEGEIGVFGQDSPIERA 66

Human    72 SGVVALPEGWNQ-NACHPLTNFSRPKQADS-WLALIER-GGCTFTHKINVAAEKGANGVIIYNYQ 133
            :|:|.||:.... .||...||||.|...:. |:|||.| ||||||.|||.|||:||..|::|| .
 Frog    67 AGLVVLPKSERTFTACKDNTNFSVPHNWNGPWIALILRGGGCTFTEKINRAAERGARAVVVYN-N 130

Human   134 GTGSKVFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMY----- 193
            |..::||.|||.||::.||:||.|:||.||:..|:.|:.|.::|||||.|..|::||.::     
 Frog   131 GMDNEVFEMSHPGTKDTVAIMIGNIKGNEIVEVIKGGMQVMMVIEVGRKHGSWINHYSIFFVSVS 195

Human   194 LFTFLAATIAY--FYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNED 256
            .|...|||:.|  ||....|||| |..|   ::..|:|.:.||||.:||||.:|:||:.|..:.|
 Frog   196 FFIVTAATVGYFIFYSARRWRLT-RAQN---KKMKQLKAEAKKAIGKLQLRTIKQGDKVLGPDGD 256

Human   257 NCVVCFDTYKPQDVVRILTCKHFFHKACIDPWLLAHRTCPMCKCDILKT 305
            :|.||.:.|||.||||||||.|||||.|||||||.|||||||||||||:
 Frog   257 SCAVCIEPYKPSDVVRILTCNHFFHKNCIDPWLLEHRTCPMCKCDILKS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF148NP_932351.1 PA_GRAIL_like 43..177 CDD:239037 66/136 (49%)
zf-RING_2 256..299 CDD:290367 33/42 (79%)
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037 66/136 (49%)
COG5540 <208..302 CDD:227827 58/97 (60%)
RING-H2_RNF128_like 256..304 CDD:319716 38/47 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I41587
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.