DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-A and Dop1R1

DIOPT Version :9

Sequence 1:NP_523844.2 Gene:mAChR-A / 37892 FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster


Alignment Length:351 Identity:107/351 - (30%)
Similarity:153/351 - (43%) Gaps:82/351 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLALAAHGPPSILEPLFKTVTTSTT-----TTTTTTTSTTTT-----TASPAGYSP--------- 51
            ::|..|.|..|:.    .||.||||     :||...||:.||     |:...|:|.         
  Fly     7 AIAAIAAGVGSVA----ATVATSTTSSISSSTTIINTSSATTIGGNHTSGSTGFSTNSTLLDADH 67

  Fly    52 -----------------------GYPGTTLLTALFENLTSTAASGLYDPYSGMYGNQTNGTIGFE 93
                                   ||.||| ||:.:...:.|.||.:             .||..|
  Fly    68 LPLQLTTAKVDLDIEIDIQLLTNGYDGTT-LTSFYNESSWTNASEM-------------DTIVGE 118

  Fly    94 TKGPRYSLASMVVMGFVAAILSTVTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIGAISM 158
            ...| .||.|:||:|...::|..::||||::|.::...::.|:.|.|.||.||||||..:.::.|
  Fly   119 EPEP-LSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVM 182

  Fly   159 PLFAVTTILGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAV 223
            ....|..:||||..|...||||:|.|.:.|.||:|||..||.|||..:..||.|....|...|.:
  Fly   183 TFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVI 247

  Fly   224 MIGAAW---------GISLLLWPPWIYSWPYI---EGKRTVPKDECYIQFIETNQYITFGTALAA 276
            .|.|.|         .|||.:..|   ..|.|   .||:   ...|.:....|...:   ::..:
  Fly   248 TIAAIWLLAAFVSFVPISLGIHRP---DQPLIFEDNGKK---YPTCALDLTPTYAVV---SSCIS 303

  Fly   277 FYFPVTIMCFLYWRIWRETKKRQKDL 302
            ||||..:|..:|.|::...:|..|.:
  Fly   304 FYFPCVVMIGIYCRLYCYAQKHVKSI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 52/132 (39%)
7tm_1 121..>314 CDD:278431 65/194 (34%)
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 50/131 (38%)
7tm_1 145..431 CDD:278431 65/194 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.