DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-A and mAChR-C

DIOPT Version :9

Sequence 1:NP_523844.2 Gene:mAChR-A / 37892 FlyBaseID:FBgn0000037 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster


Alignment Length:313 Identity:75/313 - (23%)
Similarity:130/313 - (41%) Gaps:57/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TTTASPAGYSPGYPGTTLLTALFENLTSTAASGLYDPYSGMYGNQTNGTIGFETKGPRYSLASMV 105
            |:::|||               ::..:|..|.|:. |:...:.|.|........:...:....::
  Fly     4 TSSSSPA---------------WDYRSSPEALGVV-PFLWQHQNATETPTEITLQATSFGAGHLL 52

  Fly   106 VMGFVAAILSTVTVAGNVMVMISFKIDKQLQT-ISNYFLFSLAIADFAIGAISMP---LFAVTTI 166
            .:. :.|.|..:.:.||::.:::.:..:.|:: |||.|:.|||::||.:| :::|   :|.:.:.
  Fly    53 WLA-INAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLVFYMGSD 115

  Fly   167 LGYWPLGPIVCDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRAKRTTNRAAVMIGAAW-- 229
            :|.. .||.:...:|.:  .|...|:|.|:.|:.|||.:|...|.||...|...|..:|...|  
  Fly   116 IGAM-RGPCLLRFFLLI--CACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCL 177

  Fly   230 GISLLLWPPWIYSWPYIEGKRTVPKDECYIQFIETNQYITFGTALAAFYFPVTIMCFLYWRIWRE 294
            |..:.|.|.:...||..:.        |....:....||. |.....|......|..:||||.||
  Fly   178 GALVALLPVFWNRWPDAQA--------CEFDEVLAPGYIA-GVITPGFVIIWICMFLVYWRIMRE 233

  Fly   295 TKKRQKDLPNLQAGKKDSSKRSNSSDENTVVNHASGGLLAFAQVGGNDHDTWR 347
            ..|        ||.:...|...|:.:..|:.|     ||.        |..|:
  Fly   234 ASK--------QALRLRQSVVYNTDEATTMRN-----LLL--------HPDWK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-ANP_523844.2 7tm_4 117..>241 CDD:304433 38/129 (29%)
7tm_1 121..>314 CDD:278431 55/198 (28%)
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 63/239 (26%)
7tm_1 67..321 CDD:278431 63/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.