DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bs and MAF4

DIOPT Version :9

Sequence 1:	NP_001286837.1	Gene:	bs / 37890	FlyBaseID:	FBgn0004101	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	NP_001190617.1	Gene:	MAF4 / 836631	AraportID:	AT5G65070	Length:	232	Species:	Arabidopsis thaliana

Alignment Length:	58	Identity:	25/58 - (43%)
Similarity:	41/58 - (70%)	Gaps:	0/58 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFAT 223
            ||.|::::.|:||..|..||.||:.|:|:||.:||.|..:.|.|::.|.||.:|:|::
plant     2 GRRKVEIKRIENKSSRQVTFCKRRNGLMEKARQLSILCESSVALIIISATGRLYSFSS 59

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bs	NP_001286837.1	MADS_SRF_like	166..247	CDD:238166	25/58 (43%)
MAF4	NP_001190617.1	MADS_MEF2_like	2..>61	CDD:238165	25/58 (43%)
MAF4	NP_001190617.1	K-box	<145..196	CDD:396188
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5068
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810