powered by:
Protein Alignment bs and AGL71
DIOPT Version :9
Sequence 1: | NP_001286837.1 |
Gene: | bs / 37890 |
FlyBaseID: | FBgn0004101 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001190517.2 |
Gene: | AGL71 / 835262 |
AraportID: | AT5G51870 |
Length: | 229 |
Species: | Arabidopsis thaliana |
Alignment Length: | 70 |
Identity: | 26/70 - (37%) |
Similarity: | 47/70 - (67%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 161 GKKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRK 225
|...:|:::||. |:|...|..|||||::|:.|||:|||.|...||..:|.|::|.::.:::.:
plant 9 GTMVRGKIEIKK--IENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQSGRLHEYSSSQ 71
Fly 226 LQPMI 230
::.:|
plant 72 MEKII 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
bs | NP_001286837.1 |
MADS_SRF_like |
166..247 |
CDD:238166 |
25/65 (38%) |
AGL71 | NP_001190517.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5068 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.