DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and AGL93

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_198047.1 Gene:AGL93 / 832753 AraportID:AT5G26950 Length:289 Species:Arabidopsis thaliana


Alignment Length:326 Identity:64/326 - (19%)
Similarity:109/326 - (33%) Gaps:126/326 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KKTKGRVKIKMEYIDNKL------RRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYT 220
            ||||..|:.:..:..:.|      ::.|..|.|:..:.|||.|||||....|.::.....|    
plant     9 KKTKLSVRNQTCFKKSSLSSSSTAKKTTNLSMREQTMFKKALELSTLCNIDVCVIYYGRDG---- 69

  Fly   221 FATRKLQPMITSEAGKQLIQTCLNSPDPPS-VGGGDQRMSATG-------------------FEE 265
                            :||:|.   ||..| |....:|.|...                   .::
plant    70 ----------------KLIKTW---PDDQSKVRDMAERFSRLHERERCKKRTNLSLFLRKKILDD 115

  Fly   266 TELSYNIAD-EDS---------------KDDRSPTSSGNESDDSSDVEMPAEAAEVATKLPASKT 314
            |:||..:.: |||               :.:::.|..|.                  |:..:|.|
plant   116 TKLSEKVLEMEDSLESGLRVLQDKLLLLQPEKNQTEFGQ------------------TRAVSSTT 162

  Fly   315 EVSAPPAASCSAATASSGH--KTMPALNYQTDTNSGPSTSTAAGGGGSADSKYVYSAASIANIPQ 377
            ...:||    .:......|  :|.|.::..::|....|||:.: ...|..|.::|:         
plant   163 NPLSPP----PSLIEDHRHQQRTEPLMSGVSNTEQDLSTSSLS-QNQSKFSVFLYN--------- 213

  Fly   378 KMLRQLIQSGHLQVHAEEDGNQYVTIPLSSTAANLIKSNKLTASG-SGASGSGTPVKNDASADKP 441
                             .|...:..:|.|.::     .:.||::| .|..|||.    .:|.|.|
plant   214 -----------------HDNCSFYQVPDSVSS-----FDSLTSTGLLGEQGSGL----GSSFDLP 252

  Fly   442 L 442
            :
plant   253 M 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 18/86 (21%)
AGL93NP_198047.1 MADS_SRF_like 35..103 CDD:238166 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.