DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and AGL34

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_850888.2 Gene:AGL34 / 832732 AraportID:AT5G26580 Length:345 Species:Arabidopsis thaliana


Alignment Length:307 Identity:76/307 - (24%)
Similarity:105/307 - (34%) Gaps:97/307 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTF-------AT 223
            |..|:|:..|.|::.|.|:|.|||.|||||.||||||.|.|...|:.|....|..|       .|
plant     2 GMKKVKLSLIANEISRETSFMKRKNGIMKKLYELSTLCGVQACTLIYSPFIPVPEFLEMSPTART 66

  Fly   224 RKLQPMIT------SEAGKQL------------------------------------IQTCLN-- 244
            ||:....|      ::|.:||                                    :.:|:|  
plant    67 RKMMNQETYLMERITKAKEQLQNLVGANQELQVRRFMFDCVEGKMSQYRYDAKDLQDLLSCINLY 131

  Fly   245 --------------SPDPPSVGGGDQRMSATGFEETELSYNIADEDSKDDRSPTSSGNESDDSSD 295
                          ....|||.....|:   |.|||      .||.|.|  ||..:.....|:.:
plant   132 LDQLNGRIEILKEHGDSLPSVSPFPTRI---GVEET------GDESSSD--SPILATTGVVDTPN 185

  Fly   296 VEMP-AEAAEVATKLPASKTEVSAPPAASCSAATASSGHKTMPALNYQTDTNSGP-----STSTA 354
            ...| ...|:....|.|:.|.|:||        ...|.|.....:|...|.:. |     .|:..
plant   186 ATNPRVLVADTTHFLDANATAVTAP--------FGFSNHIQYKNMNMSQDLHR-PFQHLVPTNFC 241

  Fly   355 AGGGGSADSKYVYSAASIANIPQKMLRQLIQSGHLQVHAEEDGNQYV 401
            ........::..|.|.     |..|..| ||.....::..:..|||:
plant   242 DFFQNQNMNQVQYQAP-----PNDMFNQ-IQREFYNINLNQKSNQYM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 37/145 (26%)
AGL34NP_850888.2 MADS_SRF_like 2..71 CDD:238166 31/68 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.