DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bs and PI

DIOPT Version :9

Sequence 1:	NP_001286837.1	Gene:	bs / 37890	FlyBaseID:	FBgn0004101	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	NP_197524.1	Gene:	PI / 832146	AraportID:	AT5G20240	Length:	208	Species:	Arabidopsis thaliana

Alignment Length:	78	Identity:	27/78 - (34%)
Similarity:	45/78 - (57%)	Gaps:	5/78 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHV--YTFATRKLQP 228
            ||.||:::.|:|...|..|||||:.|::|||.|::.|...:|.|::.:..|.:  |...:..|..
plant     2 GRGKIEIKRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMIDYCCPSMDLGA 66

  Fly   229 MITSE---AGKQL 238
            |:...   :||:|
plant    67 MLDQYQKLSGKKL 79

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bs	NP_001286837.1	MADS_SRF_like	166..247	CDD:238166	27/78 (35%)
PI	NP_197524.1	MADS_MEF2_like	2..80	CDD:238165	27/78 (35%)
PI	NP_197524.1	K-box	83..165	CDD:396188
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5068
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR48019
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.910