DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and SEP1

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001119230.1 Gene:SEP1 / 831436 AraportID:AT5G15800 Length:262 Species:Arabidopsis thaliana


Alignment Length:294 Identity:66/294 - (22%)
Similarity:114/294 - (38%) Gaps:72/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230
            ||.:::::.|:||:.|..||:||:.|::|||||||.|...:|.|::.|..|.:|.|.:       
plant     2 GRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS------- 59

  Fly   231 TSEAGKQL--IQTCLNSPDPPSVGGGDQRMSATGFEETELSY-----------NIADEDSK---D 279
            :|...|.|  .|.|         ..|...::....:|.|.||           |:..:...   :
plant    60 SSNMLKTLDRYQKC---------SYGSIEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGE 115

  Fly   280 DRSPTSSGNESDDSSDVEMPAEAAEVATKLPASKTEVSAPPAASCSAATASSGHK------TMPA 338
            |..|.:|             .|..::..:|..|..:|.:..........:...:|      |..|
plant   116 DLGPLNS-------------KELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRA 167

  Fly   339 LNYQTDTNSGPSTSTAAGG----GGSADSKYVYSAASIANIPQKMLRQLIQSGHLQVHA----EE 395
            |..:.|...|..:....||    ||..:..|.:..|.    .|.:.:.|..:..||:..    ::
plant   168 LAMKLDDMIGVRSHHMGGGGGWEGGEQNVTYAHHQAQ----SQGLYQPLECNPTLQMGCCFGDDD 228

  Fly   396 DGNQYVTIPLSSTAANLIKSNKLTASGSGASGSG 429
            |.::|         .|.:.|.::||:....:..|
plant   229 DDDRY---------DNPVCSEQITATTQAQAQQG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 30/82 (37%)
SEP1NP_001119230.1 MADS_MEF2_like 2..77 CDD:238165 30/90 (33%)
K-box 84..171 CDD:279785 16/99 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.