DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and AGL18

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_191298.1 Gene:AGL18 / 824906 AraportID:AT3G57390 Length:256 Species:Arabidopsis thaliana


Alignment Length:191 Identity:55/191 - (28%)
Similarity:80/191 - (41%) Gaps:53/191 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230
            ||.:|:::.|:|...|..|||||:.|::|||.|||.|...:|.|::.|.||.:|.|::       
plant     2 GRGRIEIKKIENINSRQVTFSKRRNGLIKKAKELSILCDAEVALIIFSSTGKIYDFSS------- 59

  Fly   231 TSEAGKQLIQTCLNSPDPPSVGGGDQRMSATGFEETELSYNIADEDSKDDRSP-----TSSGNE- 289
                      .|:           :|.:|..|       |..|..:.|..|..     .|.||| 
plant    60 ----------VCM-----------EQILSRYG-------YTTASTEHKQQREHQLLICASHGNEA 96

  Fly   290 ---SDDSSDVEMPAEAAEVA-TKLPASKTE-VSAPPAASCSAATASSGH-----KTMPALN 340
               :|||...|:  |..::| .:|...:.| :|.|...|.......|.|     ||...||
plant    97 VLRNDDSMKGEL--ERLQLAIERLKGKELEGMSFPDLISLENQLNESLHSVKDQKTQILLN 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 27/80 (34%)
AGL18NP_191298.1 MADS_MEF2_like 2..75 CDD:238165 31/107 (29%)
K-box 94..179 CDD:396188 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48019
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.