powered by:
Protein Alignment bs and AGL41
DIOPT Version :9
Sequence 1: | NP_001286837.1 |
Gene: | bs / 37890 |
FlyBaseID: | FBgn0004101 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_180256.2 |
Gene: | AGL41 / 817229 |
AraportID: | AT2G26880 |
Length: | 184 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 19/64 - (29%) |
Similarity: | 27/64 - (42%) |
Gaps: | 19/64 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 NKKSPPANGKKTKGRVKIKMEYIDNKL-------RR---------YTTFSKRKTGIM--KKAYE 198
|:|:...|.|..|...|.| ||:.|:| || ||..|..:..|| :|.::
plant 8 NEKTNKVNEKLIKSCKKNK-EYVSNELMMQLQRGRRIHDLNLSEIYTLLSYSRETIMSFRKKFD 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
bs | NP_001286837.1 |
MADS_SRF_like |
166..247 |
CDD:238166 |
14/51 (27%) |
AGL41 | NP_180256.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5068 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.