powered by:
Protein Alignment bs and AGL33
DIOPT Version :9
Sequence 1: | NP_001286837.1 |
Gene: | bs / 37890 |
FlyBaseID: | FBgn0004101 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_180200.1 |
Gene: | AGL33 / 817172 |
AraportID: | AT2G26320 |
Length: | 109 |
Species: | Arabidopsis thaliana |
Alignment Length: | 63 |
Identity: | 26/63 - (41%) |
Similarity: | 39/63 - (61%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 162 KKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATR 224
|:..||.|:|::.|::...|.:.|||||.|:.|||.|::.|..:.:||:|.|.|.....|.||
plant 14 KENMGRKKLKLKRIESLKERSSKFSKRKKGLFKKAEEVALLCDSDIMLIVVSPTEKPTVFNTR 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5068 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.