DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and AGL33

DIOPT Version :10

Sequence 1:NP_726438.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_180200.1 Gene:AGL33 / 817172 AraportID:AT2G26320 Length:109 Species:Arabidopsis thaliana


Alignment Length:63 Identity:26/63 - (41%)
Similarity:39/63 - (61%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATR 224
            |:..||.|:|::.|::...|.:.|||||.|:.|||.|::.|..:.:||:|.|.|.....|.||
plant    14 KENMGRKKLKLKRIESLKERSSKFSKRKKGLFKKAEEVALLCDSDIMLIVVSPTEKPTVFNTR 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_726438.1 MADS_SRF_like 166..247 CDD:238166 25/59 (42%)
AGL33NP_180200.1 MADS_SRF_like 18..100 CDD:238166 25/59 (42%)

Return to query results.
Submit another query.