DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and AGL44

DIOPT Version :10

Sequence 1:NP_726438.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001324071.1 Gene:AGL44 / 815907 AraportID:AT2G14210 Length:235 Species:Arabidopsis thaliana


Alignment Length:58 Identity:27/58 - (46%)
Similarity:39/58 - (67%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFAT 223
            ||.||.:..|||...|..|||||::|::|||.|||.|...:|.:::.|.||.:|.:|:
plant     2 GRGKIVIRRIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGVIIFSSTGKLYDYAS 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_726438.1 MADS_SRF_like 166..247 CDD:238166 27/58 (47%)
AGL44NP_001324071.1 MADS_MEF2_like 2..79 CDD:238165 27/58 (47%)
K-box 82..172 CDD:460228
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.