DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and mef2cb

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_009300032.1 Gene:mef2cb / 798771 ZFINID:ZDB-GENE-040901-7 Length:483 Species:Danio rerio


Alignment Length:330 Identity:67/330 - (20%)
Similarity:117/330 - (35%) Gaps:85/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230
            ||.||::..|.::..|..||:|||.|:||||||||.|...::.|::.:.|..::.:|:..:..::
Zfish     2 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVL 66

  Fly   231 ----------TSEAGKQLIQT--------CLNSPDPPSVGGGDQRMSATGFEETELSYNIADEDS 277
                      .|.....:::|        | :||||                         |.|.
Zfish    67 LKYTEYNEPHESRTNSDIVETLRKKGLNGC-DSPDP-------------------------DADD 105

  Fly   278 KDDRSPTSSGNESDDSSDVEMPAEAAEVATKLPASKTEVSAPPAASCSAATASSGHKTMPALNYQ 342
            ....||.|.....:.:.|:::...:.:....:|:|..:::.|    .:.......|..:|..::.
Zfish   106 SVGHSPESKDKYREINDDIDLHMISRQRICAVPSSTYDMTIP----VNNQIYPGNHNLLPLAHHG 166

  Fly   343 TDTNS----------------GPSTSTAAGGGGSADSKYVYSAASIANIPQKMLRQLIQSGHLQV 391
            ...||                |...||.||.....|....|......| .:.....|:.||.:..
Zfish   167 LQRNSMSPGVTHRPPSAGGLMGTDLSTGAGTSAGKDGIPTYYRNGYGN-HRNSPGLLVSSGGMNK 230

  Fly   392 HAEEDGNQYVTIPLSSTAANL-------IKSNKLTAS-------------GSGASGSGTPVKNDA 436
            ..:......|.:.::|...:|       .|:|..:.|             ...|....|||.:.|
Zfish   231 SMQAKSPPPVNLGMNSRKPDLRVLIPPGAKNNMPSISEDVDLLLNQRINNSQSAQSLATPVVSVA 295

  Fly   437 SADKP 441
            :...|
Zfish   296 TPTLP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 28/98 (29%)
mef2cbXP_009300032.1 MADS_MEF2_like 2..78 CDD:238165 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.