Sequence 1: | NP_001286837.1 | Gene: | bs / 37890 | FlyBaseID: | FBgn0004101 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005910.1 | Gene: | BORCS8-MEF2B / 4207 | HGNCID: | 39979 | Length: | 365 | Species: | Homo sapiens |
Alignment Length: | 247 | Identity: | 58/247 - (23%) |
---|---|---|---|
Similarity: | 95/247 - (38%) | Gaps: | 62/247 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230
Fly 231 ----------TSEAGKQLIQTC------LNSPD------PPSVG---------GGDQRM------ 258
Fly 259 -SATGFEETELSYNIADEDSKDDRSPTSSGNESDDSSDVEMPAEAAEVATKLPASKTEVSAPPAA 322
Fly 323 -----SCSAATASSGHKTMPALNYQTDTNSGPSTSTAAG-GGGSADSKYVYS 368 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bs | NP_001286837.1 | MADS_SRF_like | 166..247 | CDD:238166 | 26/96 (27%) |
BORCS8-MEF2B | NP_005910.1 | MADS_MEF2_like | 2..78 | CDD:238165 | 23/75 (31%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 94..124 | 7/29 (24%) | |||
Atrophin-1 | <123..364 | CDD:331285 | 26/126 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 142..309 | 25/107 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 321..365 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5068 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |