DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and BORCS8-MEF2B

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_005910.1 Gene:BORCS8-MEF2B / 4207 HGNCID:39979 Length:365 Species:Homo sapiens


Alignment Length:247 Identity:58/247 - (23%)
Similarity:95/247 - (38%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230
            ||.||::..|.::..|..||:|||.|:||||||||.|...::.|::.:....::.:|:..:..::
Human     2 GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVL 66

  Fly   231 ----------TSEAGKQLIQTC------LNSPD------PPSVG---------GGDQRM------ 258
                      .|.....:::|.      |:.|:      |...|         |||..:      
Human    67 LKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLY 131

  Fly   259 -SATGFEETELSYNIADEDSKDDRSPTSSGNESDDSSDVEMPAEAAEVATKLPASKTEVSAPPAA 322
             :|......::.|........|   |:..|.        .:||::.....:..|.|   :.||..
Human   132 PAAPAMPSPDVVYGALPPPGCD---PSGLGE--------ALPAQSRPSPFRPAAPK---AGPPGL 182

  Fly   323 -----SCSAATASSGHKTMPALNYQTDTNSGPSTSTAAG-GGGSADSKYVYS 368
                 |.|..|:    ||.|.|...|:..........|| .||...|:.:||
Human   183 VHPLFSPSHLTS----KTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 26/96 (27%)
BORCS8-MEF2BNP_005910.1 MADS_MEF2_like 2..78 CDD:238165 23/75 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..124 7/29 (24%)
Atrophin-1 <123..364 CDD:331285 26/126 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..309 25/107 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.