DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and Mef2a

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_038936753.1 Gene:Mef2a / 309957 RGDID:1359360 Length:503 Species:Rattus norvegicus


Alignment Length:372 Identity:84/372 - (22%)
Similarity:138/372 - (37%) Gaps:109/372 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230
            ||.||::..|.::..|..||:|||.|:||||||||.|...::.|::.:.:..::.:|:..:..::
  Rat     2 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVL 66

  Fly   231 ----------TSEAGKQLIQT--------CLNSPDPPSVGGGDQRMSATGFEETELSYNIADED- 276
                      .|.....:::.        | :||||.:        |......||..|...:|: 
  Rat    67 LKYTEYNEPHESRTNSDIVEALNKKEHRGC-DSPDPDT--------SYVLTPHTEEKYKKINEEF 122

  Fly   277 ------------------SKDDRSPTSSGNE---SDDSSDVEMPAEAAEVATKLPASKTEVSAPP 320
                              |.....|.:|.|.   ::..|.:..|:.|   |:...|..:.:|.||
  Rat   123 DNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLA---ASSTLAESSMLSPPP 184

  Fly   321 A-----ASCSA-----ATASSG-------------------------HKTMPALNYQTDTNS--- 347
            |     .|..|     :|.|:|                         .:..|.|...|..||   
  Rat   185 ATLHRNVSPGAPQRPPSTGSAGGMLSTTDLTVPNGAGNSPVGNGFVNSRASPNLIGNTGANSVGK 249

  Fly   348 -GPSTSTAAGGGGSA-------DSKYVYSAASIANIPQKMLRQLIQSGHLQVHAEEDGNQYVTIP 404
             .|:.|....||||.       |.:.|...:|     :.|:..|.:...|:::|:...:...|.|
  Rat   250 VMPTKSPPPPGGGSVGMNSRKPDLRVVIPPSS-----KGMMPPLSEEEELELNAQRISSSQATQP 309

  Fly   405 LSSTAANLIKSNKLTASGSGASGSGTPVKND---ASADKPLTIKQEF 448
            |::...: :.:..|...|...|...|....|   .|||  |:..|.|
  Rat   310 LATPVVS-VTTPSLPPQGLVYSAMPTAYNTDYSLTSAD--LSALQGF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 26/98 (27%)
Mef2aXP_038936753.1 MADS_MEF2_like 2..78 CDD:238165 23/75 (31%)
HJURP_C 97..151 CDD:403531 11/61 (18%)
Herpes_BLLF1 <129..>380 CDD:282904 50/236 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5068
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.