DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bs and mef2d

DIOPT Version :9

Sequence 1:NP_001286837.1 Gene:bs / 37890 FlyBaseID:FBgn0004101 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_571392.1 Gene:mef2d / 30580 ZFINID:ZDB-GENE-990415-164 Length:529 Species:Danio rerio


Alignment Length:339 Identity:79/339 - (23%)
Similarity:127/339 - (37%) Gaps:107/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMI 230
            ||.||:::.|.::..|..||:|||.|:||||||||.|...::.|::.:.:..::.:|:..:..::
Zfish     2 GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVL 66

  Fly   231 ----------TSEAGKQLIQTCLN--------SPDPPSVGGGDQRMSATGFEETELSYNIADED- 276
                      .|.....:|: .||        ||||      ::..|.|  ..||..|...||: 
Zfish    67 LKYTEYNEPHESRTNADIIE-ALNKKEHRDSESPDP------EEPFSLT--PRTEEKYKKIDEEF 122

  Fly   277 ---------SKDDRSPTSS-------GNE-----SDDSSDV------------------------ 296
                     |....:||.|       .|:     |:.||.|                        
Zfish   123 DKMMQSYRLSSTVPAPTFSMPVTVPVSNQSPLPFSNPSSLVTTSFVTSTLTDPRLLSPQQPQLQR 187

  Fly   297 --------EMPAEAAEV----------ATKLPASKTEVSAPPAASCSAATASSGHKTMPALNYQT 343
                    :.||.|..:          |...|.:...|||  .||....:.|:|:    ::....
Zfish   188 NTVSPGLPQRPASAGALLGGDLNNSNGACPSPVANGYVSA--RASPGLLSVSNGN----SMGKVV 246

  Fly   344 DTNSGPSTSTAAGGGGSADSKYVYSAASIANIPQKMLRQLIQSGHLQV---HAEEDGNQYVTIPL 405
            ...|.|..||........|.:.:.|.:|      |.|.||... .|::   :|:..|...||.||
Zfish   247 QAKSPPPPSTQMANSRKPDLRVITSQSS------KGLMQLTDE-ELELVSENAQRLGTSQVTQPL 304

  Fly   406 SSTAANLIKSNKLT 419
            ::...::...:.||
Zfish   305 TTPVVSVATPSLLT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsNP_001286837.1 MADS_SRF_like 166..247 CDD:238166 28/98 (29%)
mef2dNP_571392.1 MADS_MEF2_like 2..78 CDD:238165 23/75 (31%)
HJURP_C 96..152 CDD:289143 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.