DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and BZIP24

DIOPT Version :10

Sequence 1:NP_523843.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_190764.2 Gene:BZIP24 / 824359 AraportID:AT3G51960 Length:228 Species:Arabidopsis thaliana


Alignment Length:94 Identity:29/94 - (30%)
Similarity:40/94 - (42%) Gaps:14/94 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 NLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKS 380
            |.|....|:.:|.....|:.|...|.    ||:..|...|||          :|...|..||||.
plant    62 NPPGPEDASHSHTCFHAHTHLIISQD----QQENDHSDSSNK----------KRLCGNREAVRKY 112

  Fly   381 REKAKVRSREVEERVKSLLKEKDALIRQL 409
            |||.|.|:..:|:.|..|....:..:|:|
plant   113 REKKKARTAYLEDEVMRLQSLNEQFLRKL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_523843.1 bZIP_CEBP 362..420 CDD:269841 16/48 (33%)
coiled coil 363..420 CDD:269841 16/47 (34%)
BZIP24NP_190764.2 bZIP_2 104..146 CDD:462244 15/38 (39%)

Return to query results.
Submit another query.