DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and hlfa

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001070802.1 Gene:hlfa / 768192 ZFINID:ZDB-GENE-061013-159 Length:294 Species:Danio rerio


Alignment Length:329 Identity:62/329 - (18%)
Similarity:105/329 - (31%) Gaps:107/329 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DMVTSPGGLSAT-LPPS-GMVSAAAKVLQQQTLRNQHGYGGRGGGGGAGGALAYMPQPVHATYNN 216
            :.::.|..::|| |||: |::.:..:...:....:..|:|                        .
Zfish     2 EKMSRPLPINATFLPPTHGVLKSLLENPMKLPFHHDEGFG------------------------K 42

  Fly   217 SSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFMG----------NGAGLYNGYGSGANG 271
            ..::...:..|:||:.                :.|:||:|          |.......|......
Zfish    43 EKEKEKKLEDDASTLN----------------TPQSAFLGPTLWDKTLPYNADNFQLEYMDLEEF 91

  Fly   272 LTGGGNPLN----------------GGNTTPS----SNGSNGSTGSSNGSQFTNLTTANVLAHHN 316
            |.....|.|                ....|||    ||..|.|  |.||     :...|.|.:..
Zfish    92 LLENNIPANPQSEQSQPSQPPLQPPSAPPTPSVVDLSNRDNSS--SHNG-----MVAQNCLQNPT 149

  Fly   317 LPHLAAAAGAHNLLKQHS------------KLHAQQQHQQHQQQQQHRKHSNKHV---------- 359
            .|.|.|:....:.:...|            .|.......|.....:.||.|.:.:          
Zfish   150 RPGLPASRDTPSPIDPDSIQVPLAYEPDPADLALSSVPGQEIFDPRKRKFSAEELKPQPMIKKAR 214

  Fly   360 ------DKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQL 418
                  |...|.|..||.:||||.::||:..:::..::..|...|.||..||..::.::..||..
Zfish   215 KVFIPEDLKDDRYWARRRKNNIAAKRSRDARRLKENQIAIRAGFLEKENAALRAEVADLRKELGR 279

  Fly   419 HKQI 422
            .|.:
Zfish   280 CKNV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 18/57 (32%)
coiled coil 363..420 CDD:269841 18/56 (32%)
hlfaNP_001070802.1 bZIP_HLF 223..282 CDD:269843 18/58 (31%)
coiled coil 224..282 CDD:269843 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.