DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and ddit3

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_005166228.1 Gene:ddit3 / 561924 ZFINID:ZDB-GENE-070410-90 Length:242 Species:Danio rerio


Alignment Length:206 Identity:39/206 - (18%)
Similarity:68/206 - (33%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 PVHAT---YNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFMGNGAGLYNGYGSGAN 270
            |||.:   ....:.||:|.|        :.:.||:...|.|.        |.|..:.||      
Zfish    82 PVHQSPPRQEERTTENTSSG--------DLLPPEFFELLSEG--------GVGDTMVNG------ 124

  Fly   271 GLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSK 335
               |.|..|:    .|.|..:         |:...|.|        :|..::.:.|    .:...
Zfish   125 ---GAGYHLH----APPSPAA---------SEEEELPT--------VPDTSSCSSA----SRSPS 161

  Fly   336 LHAQQQHQQHQQQQQHRKHSNK--HVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSL 398
            |:............:.||....  ....|....|.|.:.|...|::..::.:....|:|...:.:
Zfish   162 LNCSPPASPPVSSSRKRKRGGALCSASPGKKSRREREQENERKVQELTDQNERLKAEIERLGEEV 226

  Fly   399 LKEKDALIRQL 409
            .:.:.|||.:|
Zfish   227 QRTRRALIERL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 11/48 (23%)
coiled coil 363..420 CDD:269841 10/47 (21%)
ddit3XP_005166228.1 bZIP <204..235 CDD:304365 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.