Sequence 1: | NP_001286836.1 | Gene: | slbo / 37889 | FlyBaseID: | FBgn0005638 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005166228.1 | Gene: | ddit3 / 561924 | ZFINID: | ZDB-GENE-070410-90 | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 39/206 - (18%) |
---|---|---|---|
Similarity: | 68/206 - (33%) | Gaps: | 55/206 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 PVHAT---YNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFMGNGAGLYNGYGSGAN 270
Fly 271 GLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSK 335
Fly 336 LHAQQQHQQHQQQQQHRKHSNK--HVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSL 398
Fly 399 LKEKDALIRQL 409 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slbo | NP_001286836.1 | bZIP_CEBP | 362..420 | CDD:269841 | 11/48 (23%) |
coiled coil | 363..420 | CDD:269841 | 10/47 (21%) | ||
ddit3 | XP_005166228.1 | bZIP | <204..235 | CDD:304365 | 5/30 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |