DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and hlfb

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_005156391.1 Gene:hlfb / 557886 ZFINID:ZDB-GENE-110420-3 Length:300 Species:Danio rerio


Alignment Length:260 Identity:52/260 - (20%)
Similarity:79/260 - (30%) Gaps:108/260 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GYG---SGANGLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQF--TNLTTANVLAHHNLPHLAAA 323
            |||   .....|...|||.......|:   ....|.|.:|..|  ..:.....|:.:.:|. :.|
Zfish    37 GYGKERDKVKKLDEEGNPPQSAFLGPT---LWDKTLSYDGDSFQLEYMDLEEFLSENGIPS-SPA 97

  Fly   324 AGAHNLLKQHSKLHAQQQHQQHQQQQQH------------------------------------- 351
            ....||.:.|   |.|||.||||||||.                                     
Zfish    98 QHDQNLHQHH---HQQQQQQQHQQQQQQVSMPQGPISVMDLSSRSIHTAISPQNCLHSPGRSVLP 159

  Fly   352 ------------------------------------------RKHSNKHVD-------------- 360
                                                      ||.|.:.:.              
Zfish   160 PSRNTPSPVDPEALHIPVSYEPDPADLALSSVPGQEVFDPRKRKFSEEELKPQPMIKKARKIFIP 224

  Fly   361 ---KGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQI 422
               |..::|..||.:||:|.::||:..:::..::..|...|.||..||.:::.::..||...|.|
Zfish   225 DDLKQDEKYWARRRKNNVAAKRSRDARRLKENQIAIRAGFLEKENMALRQEVADLRKELGRCKNI 289

  Fly   423  422
            Zfish   290  289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 16/57 (28%)
coiled coil 363..420 CDD:269841 16/56 (29%)
hlfbXP_005156391.1 bZIP_HLF 230..288 CDD:269843 16/57 (28%)
coiled coil 230..288 CDD:269843 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.