Sequence 1: | NP_001286836.1 | Gene: | slbo / 37889 | FlyBaseID: | FBgn0005638 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016443.1 | Gene: | cebpg / 549197 | XenbaseID: | XB-GENE-919758 | Length: | 137 | Species: | Xenopus tropicalis |
Alignment Length: | 89 | Identity: | 34/89 - (38%) |
---|---|---|---|
Similarity: | 59/89 - (66%) | Gaps: | 6/89 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 353 KHSNK--HVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNE 415
Fly 416 LQLHKQIYMQ----LMNHANPEVS 435 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slbo | NP_001286836.1 | bZIP_CEBP | 362..420 | CDD:269841 | 25/57 (44%) |
coiled coil | 363..420 | CDD:269841 | 24/56 (43%) | ||
cebpg | NP_001016443.1 | bZIP_CEBPG | 53..111 | CDD:269861 | 24/57 (42%) |
coiled coil | 53..111 | CDD:269861 | 24/57 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4506 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |