DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and cebpg

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001016443.1 Gene:cebpg / 549197 XenbaseID:XB-GENE-919758 Length:137 Species:Xenopus tropicalis


Alignment Length:89 Identity:34/89 - (38%)
Similarity:59/89 - (66%) Gaps:6/89 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 KHSNK--HVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNE 415
            |:|.|  .:|:|::|||.||||||:||:|||.|:|.::::..:||..|.:|.:.|..::..:|.|
 Frog    41 KNSKKGQRLDRGSEEYRLRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKE 105

  Fly   416 LQLHKQIYMQ----LMNHANPEVS 435
            |.:.|.::::    |.::..||.|
 Frog   106 LSVLKDLFLEHAHNLADNVQPESS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 25/57 (44%)
coiled coil 363..420 CDD:269841 24/56 (43%)
cebpgNP_001016443.1 bZIP_CEBPG 53..111 CDD:269861 24/57 (42%)
coiled coil 53..111 CDD:269861 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.