DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and NFIL3

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001276928.1 Gene:NFIL3 / 4783 HGNCID:7787 Length:462 Species:Homo sapiens


Alignment Length:436 Identity:72/436 - (16%)
Similarity:158/436 - (36%) Gaps:129/436 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QQATIGQITLTAMSTAQQQQQQQQQQQQQ--QQQQQQQQQQQPQQQTTDANNNTSQDAAL--LVK 89
            :.:|.|:..|.:..:..:.:....:::::  ..:::.....:.:::..:|...:.:...|  ||.
Human    37 EDSTTGEELLLSEGSVGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVL 101

  Fly    90 QHAMHQMQQVAALGSNNNLLQKQMLQQYSTQTDLDELTTQEITLDLQHLIDDQFRDTETLGIFSD 154
            ::      ::.|||..|..|:.::|   |.:.....:::.....::|.|      ...|...|.|
Human   102 EN------KLIALGEENATLKAELL---SLKLKFGLISSTAYAQEIQKL------SNSTAVYFQD 151

  Fly   155 MVTSPGGLSATL---PPSGMVSAAAKVLQQQTLRNQHGYGGRGGGGGAGGALAYMPQPVHATYNN 216
            ..||...:|:.:   .||.:.|:...|::                              |:..::
Human   152 YQTSKSNVSSFVDEHEPSMVSSSCISVIK------------------------------HSPQSS 186

  Fly   217 SSD-----------ENSSVGSDSS------TIKEEPIDPE-YRRHLQE-----AASQQAAFMGNG 258
            .||           |:|..||..|      .||:||::.| |.|..::     .||....:|||.
Human   187 LSDVSEVSSVEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNS 251

  Fly   259 AGLYNGYGSGANGLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAA 323
               ::||......|....:..|...|:.:.:|..|.  ||:|                       
Human   252 ---FSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGK--SSDG----------------------- 288

  Fly   324 AGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRS 388
                            :..||..:...|.....|||.....:.   .|.|:.|:   ..|.::::
Human   289 ----------------EDEQQVPKGPIHSPVELKHVHATVVKV---PEVNSSAL---PHKLRIKA 331

  Fly   389 REVEERVKSLLKEKDALIRQLGEMTNELQLHKQIYMQLMNHANPEV 434
            :.::.:|::...|.:|    ..::::.:.:..:.:.:|..|:.|.:
Human   332 KAMQIKVEAFDNEFEA----TQKLSSPIDMTSKRHFELEKHSAPSM 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 7/57 (12%)
coiled coil 363..420 CDD:269841 7/56 (13%)
NFIL3NP_001276928.1 bZIP_NFIL3 72..131 CDD:269842 11/67 (16%)
coiled coil 76..127 CDD:269842 11/59 (19%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..95 1/15 (7%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 99..106 2/12 (17%)
Vert_IL3-reg_TF 130..461 CDD:368956 58/334 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..237 13/47 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..302 11/84 (13%)
Necessary for transcriptional repression and sufficient for interaction with DR1. /evidence=ECO:0000269|PubMed:8836190 299..363 11/73 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.