DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and vri

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001137792.1 Gene:vri / 33759 FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster


Alignment Length:366 Identity:78/366 - (21%)
Similarity:132/366 - (36%) Gaps:116/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QQTTDAN--NNTSQDAALLVKQHAMHQMQQVAALGSNNNLLQKQMLQQYSTQTDLDELTTQEITL 133
            :..||.|  ||..||      ..:.::..::.|..:|::|..:|.|||...|  |...:.|::: 
  Fly    27 KNNTDTNYINNYKQD------NPSNNKFPRIQAQSNNSHLQHQQQLQQKLAQ--LHHYSQQKLS- 82

  Fly   134 DLQHLIDDQFRDTETLGIFSDMVTSPGGLSATLPPSG-------MVSAAAKVLQQQTLRNQHGYG 191
                              .||....|      .||:|       :::...|:..:.::...    
  Fly    83 ------------------GSDFPYGP------RPPTGGKEEKLLLLAPPGKLYPEASVSTA---- 119

  Fly   192 GRGGGGGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFMG 256
                          ||:.:..|..||  .|.:..:..:.::...|.|...               
  Fly   120 --------------MPEVLSGTPTNS--HNKANIAMMNNVRLSNISPTLS--------------- 153

  Fly   257 NGAGLYNGYGSGANGLTGGGNPLN--GGNTTPSSNGSNGS-------TGSSNGSQFTNLTTANVL 312
                 .||..:.|:.|    :||:  ||:.:|.||.|..|       .||..|.        .::
  Fly   154 -----MNGSSNEASNL----HPLSMYGGSISPQSNDSGMSDSLGKYVPGSGYGD--------GMM 201

  Fly   313 AHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIAV 377
            |.      :.:.|.:.   ..|.|.|.|:....|::|:.....||.    .:.|..||.|||.|.
  Fly   202 AQ------SPSQGGNG---PQSALTAAQKELFSQRKQREFTPDNKK----DESYWDRRRRNNEAA 253

  Fly   378 RKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQL 418
            ::||||.:.....:|:||..|.||...|..||..:.::..:
  Fly   254 KRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDKFNI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 20/57 (35%)
coiled coil 363..420 CDD:269841 20/56 (36%)
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 20/61 (33%)
coiled coil 239..297 CDD:269842 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.