DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slbo and Ddit3

DIOPT Version :9

Sequence 1:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001103456.1 Gene:Ddit3 / 29467 RGDID:62391 Length:168 Species:Rattus norvegicus


Alignment Length:141 Identity:29/141 - (20%)
Similarity:60/141 - (42%) Gaps:8/141 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 SSNGSNGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQH 351
            ||:...|:..||.|::.....|...|...:|..|....|...:........:....|....|::.
  Rat    30 SSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPAEVTSTSQSPRSPDSSQSSMAQEEE 94

  Fly   352 RKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNEL 416
            .:      |:|  ..|:|::....|.|..:::.|.:.:|.|.:|..|.:|.:.|.:::..:|.|:
  Rat    95 EE------DQG--RTRKRKQSGQCAARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREV 151

  Fly   417 QLHKQIYMQLM 427
            :..::..:..|
  Rat   152 ETTRRALIDRM 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 14/57 (25%)
coiled coil 363..420 CDD:269841 13/56 (23%)
Ddit3NP_001103456.1 N-terminal. /evidence=ECO:0000250 10..26
Interaction with TRIB3. /evidence=ECO:0000250 10..18
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..130 20/103 (19%)
coiled coil 98..152 CDD:269834 14/55 (25%)
BRLZ 100..160 CDD:197664 13/59 (22%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 100..129 7/28 (25%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 133..147 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.